Cagrilintide 5mg + Semaglutide 5mg

Researchers investigate Cagrilintide and Semaglutide combination within controlled laboratory environments to examine dual-peptide mechanisms. Experimental receptor-binding models utilize this compound system to study combined peptide interactions in vitro. Controlled laboratory peptide stability studies assess compound properties under standardized experimental conditions. Scientists explore dual-mechanism interactions and synergistic pathway characteristics in research settings. Laboratory personnel examine dual-peptide behavior in experimental models designed for combination peptide research. These investigations occur exclusively in controlled research environments without clinical applications.

Cagrilintide and Semaglutide combination is investigated in research environments to understand dual-peptide mechanism interactions. This compound system is studied within controlled laboratory models examining combination peptide properties. Researchers explore this formulation for experimental peptide research applications in academic and institutional settings. Laboratory studies examine the compounds’ combined characteristics under standardized protocols. Scientists investigate structural properties relevant to dual-mechanism research methodologies. All research applications remain confined to laboratory environments and experimental frameworks.

Store the dual-peptide formulation in cool, dry conditions protected from light exposure. Storage temperature should remain consistent to maintain compound stability. Keep the product sealed until ready for laboratory use. Laboratory handling should occur only by qualified research personnel trained in peptide research protocols. Avoid exposure to moisture, heat, and direct sunlight during storage. Use appropriate laboratory equipment when handling this research compound. Reconstitution should follow standard laboratory peptide preparation procedures using sterile techniques. Maintain proper documentation of handling and storage conditions for research records. Dispose of unused material according to institutional laboratory waste protocols.

Each batch undergoes comprehensive purity verification procedures to confirm research-grade quality for both peptide components. Third-party testing validates compound purity at 99%+ by HPLC analysis for each peptide. Batch-to-batch consistency ensures reliable results across research protocols. Certificate of Analysis accompanies each order documenting purity verification results for both compounds. Internal quality assurance standards maintain strict specifications for dual-peptide formulations. Testing procedures verify molecular weight, purity percentage, and compound identity for each component. Research-grade supply positioning ensures suitability for controlled laboratory investigations. Quality control documentation supports institutional research compliance requirements.

• CAS: Cagrilintide: 1415456-99-3 Semaglutide: 910463-68-2
• Chemical Formula: Cagrilintide: C₁₉₄H₃₁₂N₅₄O₅₉S₂ Semaglutide: C₁₈₇H₂₉₁N₄₅O₅₉
• Molecular Weight: Cagrilintide:4409 g/mol Semaglutide: 4114 g/mol
• Peptide Sequence: Cagrilintide: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Semaglutide: H-His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(AEEAc-AEEAc-γ-Glu-17-carboxyheptadecanoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-OH
• Synonyms: CagriSema
• Shelf life: 24 months from the manufacturing date.

This formulation contains two synthetic peptide compounds produced for research applications. Cagrilintide is a synthetic amylin analog peptide. An amylin analog is a modified version of the amylin peptide hormone. Semaglutide is a synthetic GLP-1 receptor agonist peptide. A GLP-1 receptor agonist is a molecular structure designed to interact with GLP-1 receptors. Both peptides have specific molecular structures studied in laboratory test systems. This dual-peptide combination allows researchers to investigate how different peptide mechanisms interact in experimental settings. This synthetic peptide origin ensures batch-to-batch consistency for research protocols. The compounds consist of defined amino acid sequences with specific modifications. Researchers examine these peptides’ properties within controlled laboratory conditions without therapeutic context.

This synthetic research peptide formulation provides laboratories with a dual-compound system for experimental studies. The combined 5mg format supports controlled research applications examining multiple peptide mechanisms. Each batch undergoes rigorous purity verification to ensure consistency across research protocols. High-purity formulation meets research-grade standards for dual-peptide investigations. Secure packaging protects compound integrity during storage and transport. Discreet shipment ensures confidential delivery to research facilities and institutional laboratories.

Research applications include dual-mechanism pathway studies, peptide interaction characterization, synergistic effect investigations, comparative analyses between single and dual-peptide systems, and combination peptide stability studies. Specific applications depend on research objectives in peptide pharmacology and receptor biology. Research teams determine protocols based on their investigation goals in multi-mechanism peptide studies.

The dual-peptide formulation should be stored at 2-8°C in light-protected conditions following institutional laboratory standards. After reconstitution, both peptides should be stored together at 2-8°C according to institutional protocols. Researchers should establish appropriate stability testing and storage validation procedures for combination peptide formulations in their specific experimental applications.

Each batch includes a comprehensive Certificate of Analysis documenting purity verification, molecular weight confirmation, and quality control data for both Cagrilintide and Semaglutide components. Testing includes individual HPLC analysis for each peptide and verification of the combined formulation. All documentation meets research-grade standards for dual-peptide compounds and supports institutional compliance requirements.